ME2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 526-556 amino acids from the C-terminal region of Human NAD-ME |
ME2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 526-556 amino acids from the C-terminal region of Human NAD-ME |
Rabbit Polyclonal Anti-ME2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ME2 antibody: synthetic peptide directed towards the N terminal of human ME2. Synthetic peptide located within the following region: MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG |