Primary Antibodies

View as table Download

U2AF1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human U2AF1

Rabbit Polyclonal Anti-U2AF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-U2AF1 antibody: synthetic peptide directed towards the N terminal of human U2AF1. Synthetic peptide located within the following region: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN