Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to PIG3 (tumor protein p53 inducible protein 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of PIG3 (Uniprot ID#Q53FA7)

Rabbit Polyclonal PIG3 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-TP53I3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53I3 antibody is: synthetic peptide directed towards the C-terminal region of Human TP53I3. Synthetic peptide located within the following region: SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL

TP53I3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated