Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-C5a Anaphylatoxin Receptor (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)DKDTLDLNTPVDK, corresponding to amino acid residues 16-28 of human C5aR (Accession P21730 ). Extracellular, N-terminus.

Rabbit Polyclonal Anti-C5AR1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen C5AR1 / CD88 / C5a Receptor antibody was raised against synthetic 18 amino acid peptide from internal region of human C5AR1 / CD88. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Gibbon (89%).

Rabbit Polyclonal Anti-C5AR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK

C5AR1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human C5AR1

C5AR1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human C5AR1 (NP_001727.1).
Modifications Unmodified

Recombinant Anti-C5aR (Clone S5/1)

Applications Bl, ELISA, FC, IP, WB
Reactivities Ferret, Human, Rabbit, Cow
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-C5aR (Clone 32-G1)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.