C5R1 (C5AR1) Rabbit Polyclonal Antibody

CAT#: TA342835

Rabbit Polyclonal Anti-C5AR1 Antibody

Product Images

WB Suggested Anti-C5AR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: complement component 5a receptor 1
• Database Link:
  NP_001727
  Entrez Gene 728 Human
  UniProt ID P21730
• Background: C5AR1 is the receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
• Synonyms: C5A; C5AR; C5R1; CD88
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Horse: 92%; Sheep: 85%; Bovine: 85%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Complement and coagulation cascades, Neuroactive ligand-receptor interaction