Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-PDPN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT |
Rabbit Polyclonal Anti-PDPN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the middle region of human PDPN. Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM |
Rabbit Polyclonal Anti-PDPN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PDPN |
Podoplanin Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Podoplanin |
Podoplanin Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Podoplanin |
Active filters
Target Symbol
- PDPN
Reactivities
- Human
Antibody Hosts
- Rabbit