PDPN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDPN |
PDPN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDPN |
Rabbit Polyclonal Anti-PDPN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT |
Rabbit Polyclonal Anti-PDPN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the middle region of human PDPN. Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM |
Rabbit Polyclonal Anti-PDPN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDPN |
Podoplanin Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Podoplanin |
Podoplanin Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Podoplanin |