Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GNB2L1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the N terminal of human GNB2L1. Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI

Rabbit Polyclonal Anti-GNB2L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the C terminal of human GNB2L1. Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW

Rabbit anti-GNB2L1 Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNB2L1

Rabbit Polyclonal Antibody against GNB2L1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1.

Rabbit Polyclonal Anti-GNB2L1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GNB2L1

RACK1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RACK1

RACK1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human RACK1 (NP_006089.1).
Modifications Unmodified

RACK1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human RACK1 (NP_006089.1).
Modifications Unmodified

RACK1 Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated