RACK1 Rabbit Polyclonal Antibody

CAT#: TA345945

Rabbit Polyclonal Anti-GNB2L1 Antibody

Product Images

WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate; GNB2L1 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Sample Type: MCF-7 WT a whole cell lysates (110UG); Primary Dilution: 1.5mg/mL; Secondary Antibody:LI-COR Donkey anti-rabbit; Secondary Dilution: 1: 10,000G; NB2L1 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the C terminal of human GNB2L1. Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: receptor for activated C kinase 1
• Database Link:
  NP_006089
  Entrez Gene 10399 Human
  UniProt ID P63244
• Background: GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton.
• Synonyms: Gnb2-rs1; GNB2L1; H12.3; HLC-7; PIG21
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%

Reference Data

• Protein Families: Druggable Genome