Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RORC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC antibody is: synthetic peptide directed towards the N-terminal region of Human RORC. Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG

Rabbit polyclonal anti-RORG antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RORG.

Rabbit Polyclonal ROR gamma/RORC/NR1F3 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 1-50 of human ROR gamma was used as the immunogen.

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORC antibody: synthetic peptide directed towards the N terminal of human RORC. Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

Rabbit Polyclonal Anti-RORC Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen RORC / ROR Gamma antibody was raised against synthetic 18 amino acid peptide from ligand-binding domain of human ROR Gamma. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Tamarin, Elephant, Bat (100%); Bovine, Rabbit, Horse (94%); Mouse, Rat, Hamster, Panda (89%); Dog (83%).

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the C terminal of human RORC. Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the middle region of human RORC. Synthetic peptide located within the following region: CHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPD

RORC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human RORC (NP_005051.2).
Modifications Unmodified