CNP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNP |
CNP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNP |
Rabbit anti-CNP Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CNP |
rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rabbit, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase |
Rabbit Polyclonal Anti-CNP Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF |
CNP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNP |