CNPase (CNP) Rabbit Polyclonal Antibody

CAT#: TA334680

Rabbit Polyclonal Anti-CNP Antibody

Product Images

Lanes: 1. Human NT-2 cells (60ug) lysate 2. Rat brain extract (80ug); Primary Antibody Dilution: 2 ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution: ; 1: 20,000; Gene Name: ; CNP; Submitted by: ;

• 

  WB Suggested Anti-CNP Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysateCNP is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  IP Suggested Anti-CNP Antibody ; Positive Control: NT2 CELL/BRAIN TISSUE

• 

  Amount and Sample Type. 500 ug mouse brain homogenate; Amount of IP Antibody. 6 ug; Primary Antibody. CNP; Primary Antibody Dilution. 1:500; Secondary Antibody. Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution. 1:5000; Gene Name. CNP;

Specifications

Product Data

• Applications: IP, WB
• Recommended Dilution: WB, IP
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: 2',3'-cyclic nucleotide 3' phosphodiesterase
• Database Link:
  NP_149124
  Entrez Gene 12799 MouseEntrez Gene 25275 RatEntrez Gene 1267 Human
  UniProt ID P09543
• Background: 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm
• Synonyms: CNP1
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Sheep: 100%; Dog: 92%; Pig: 92%; Bovine: 85%; Rat: 77%