Primary Antibodies

View as table Download

CKII alpha (CSNK2A1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal CKII alpha (CSNK2A1) Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CKII alpha (CSNK2A1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-269 amino acids from the Central region of human CKII alpha (CSNK2A1).

CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around phosphorylation site of Threonine 360/Serine 362

CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around phosphorylation site of Threonine 360/Serine 362

CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa. 353~357

CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa. 353~357

Rabbit polyclonal anti-R Csnk2a1 antibody (N-term)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This Rat Csnk2a1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-50 amino acids from the N-terminal region of Rat Csnk2a1.

Phospho-CSNK2A1-T360/S362 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T360/S362 of human CSNK2A1
Modifications Phospho-specific

Rabbit Polyclonal Anti-CSNK2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK2A1 antibody: synthetic peptide directed towards the middle region of human CSNK2A1. Synthetic peptide located within the following region: LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP

Anti-CSNK2A1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 39-324 amino acids of human casein kinase 2, alpha 1 polypeptide

Anti-CSNK2A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 39-324 amino acids of human casein kinase 2, alpha 1 polypeptide

Casein Kinase 2 alpha (CSNK2A1) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-391 of human Casein Kinase 2 alpha (CSNK2A1) (NP_001886.1).
Modifications Unmodified

Casein Kinase 2 alpha (CSNK2A1) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-391 of human Casein Kinase 2 alpha (CSNK2A1) (NP_001886.1).
Modifications Unmodified

CKII alpha Rabbit polyclonal Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human CKII alpha