Primary Antibodies

View as table Download

EPO (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 20-48 amino acids from the N-terminal region of Human Erythropoietin.

Rabbit anti-EPO Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EPO

Rabbit Polyclonal Anti-EPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD

Rabbit Polyclonal Anti-EPO Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPO Antibody: A synthesized peptide derived from human EPO

Rabbit Polyclonal Anti-EPO Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPO

EPO rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPO

EPO Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Produced from sera of rabbits immunized with highly pure Recombinant Human EPO. Anti-Human EPO-specific antibody was purified by affinity chromatography employing an immobilized Human EPO matrix.

EPO Antibody (biotin)

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Produced from sera of rabbits immunized with highly pure Recombinant Human EPO. Anti-Human EPO-specific antibody was purified by affinity chromatography and then biotinylated.