Primary Antibodies

Jump to Filters
View as table Download
NEK7 Rabbit Polyclonal Antibody
TA371236

USD 380.00

4 Weeks

NEK7 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEK7
NEK7 Rabbit Polyclonal Antibody
TA308429

USD 415.00

5 Days

Rabbit Polyclonal antibody to NEK7 (NIMA (never in mitosis gene a)-related kinase 7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 238 and 302 of NEK7 (Uniprot ID#Q8TDX7)
NEK7 Rabbit Polyclonal Antibody
TA329575

USD 375.00

5 Days

Rabbit polyclonal anti-NEK7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEK7 antibody: synthetic peptide directed towards the N terminal of human NEK7. Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI
Nek7 Rabbit Polyclonal Antibody
TA356759

USD 360.00

5 Days

Nek7 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
NEK7 Rabbit Polyclonal Antibody
TA366935

USD 380.00

4 Weeks

NEK7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEK7