NEK7 Rabbit Polyclonal Antibody

CAT#: TA329575

Rabbit polyclonal anti-NEK7 antibody

Product Images

WB Suggested Anti-NEK7 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NEK7 antibody: synthetic peptide directed towards the N terminal of human NEK7. Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: NIMA related kinase 7
• Database Link:
  NP_598001
  Entrez Gene 140609 Human
  UniProt ID Q8TDX7
• Background: NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis. [supplied by OMIM]
• Synonyms: NIMA (never in mitosis gene a)-related kinase 7; NIMA-related kinase 7; OTTHUMP00000033680
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93%; Yeast: 92%; Goat: 79%; Sheep: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase