TBK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBK1 |
TBK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBK1 |
Rabbit Polyclonal NAK Antibody
Applications | IF |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | NAK antibody was raised against a synthetic peptide corresponding to 17 amino acids form near the carboxy terminus of human NAK/TBK1. |
Rabbit Polyclonal Anti-TBK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the N terminal of human TBK1. Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM |
Rabbit Polyclonal Anti-TBK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the middle region of human TBK1. Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ |
Phospho-TBK1/NAK-S172 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S172 of human TBK1/NAK (NP_037386.1). |
Modifications | Phospho S172 |
TBK1 Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Hamster, Human, Rat |
Conjugation | Unconjugated |