Primary Antibodies

View as table Download

TNFSF18 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF18

TNFSF18 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF18

Rabbit Polyclonal GITRL Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen GITRL antibody was raised against purified recombinant human GITR ligand.

TNFSF18 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of human TNFSF18

Anti-Human AITRL Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human AITRL

Rabbit Polyclonal Anti-TNFSF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF18 antibody: synthetic peptide directed towards the middle region of human TNFSF18. Synthetic peptide located within the following region: KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN

TNFSF18 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF18

TNFSF18 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF18

Recombinant Anti-GITRL (Clone YGL386)

Applications ELISA, FC
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-GITR (Clone YGITR765)

Applications FC
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques.