ALDH5A1 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | 22 amino acid peptide near the carboxy terminus of the human Aldh5A1 |
ALDH5A1 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | 22 amino acid peptide near the carboxy terminus of the human Aldh5A1 |
Rabbit Polyclonal Aldh5A1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Aldh5A1 antibody was raised against a 22 amino acid peptide near the carboxy terminus of the human Aldh5A1. |
Rabbit Polyclonal Anti-ALDH5A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH5A1 antibody: synthetic peptide directed towards the middle region of human ALDH5A1. Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM |
Anti-ALDH5A1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 514-529 amino acids of human aldehyde dehydrogenase 5 family, member A1 |
Anti-ALDH5A1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 514-529 amino acids of human aldehyde dehydrogenase 5 family, member A1 |
ALDH5A1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ALDH5A1 (NP_001071.1). |
Modifications | Unmodified |