Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-C1QA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG

C1QA rabbit polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen The subunit C1q is isolated as a homogenous protein for use in antiserum production.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

C1QA Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-245 of human C1QA (NP_057075.1).
Modifications Unmodified

C1QA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli.

C1QA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli.