Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259)

GAD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAD1

Rabbit polyclonal anti-GAD67/GAD1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GAD67.
Modifications Phospho-specific

Rabbit Polyclonal Anti-GAD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GAD1 Antibody: A synthesized peptide derived from human GAD1

Rabbit Polyclonal Anti-GAD1/2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GAD1/2 Antibody: A synthesized peptide derived from human GAD1/2

GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated

GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Feline, Human, Mouse, Rat
Immunogen Synthetic peptide sequence from the C-terminus of GAD

Rabbit Polyclonal Anti-Gad1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gad1 Antibody: synthetic peptide directed towards the N terminal of human Gad1. Synthetic peptide located within the following region: TRKLGLKICGFLQRTNSLEEKSRLVSAFRERQSSKNLLSCENSDQGARFR

Rabbit anti-GAD1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GAD1

Rabbit Polyclonal Anti-GAD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GAD1 Antibody: synthetic peptide directed towards the N terminal of human GAD1. Synthetic peptide located within the following region: MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF

Rabbit Polyclonal Anti-GAD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAD1

Rabbit Polyclonal Anti-GAD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAD1

GAD67 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human GAD67