Germany
Japan
United Kingdom
China
Rabbit Polyclonal Kallikrein 5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Residues 280-293 [KFTKWIQETIQANS] of the human KLK-L2 protein. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-KLK5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KLK5 Antibody: synthetic peptide directed towards the N terminal of human KLK5. Synthetic peptide located within the following region: CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL |
Anti-KLK5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 279-293 amino acids of Human kallikrein-related peptidase 5 |
KLK5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KLK5 (NP_001070959.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KLK5
Antibody Hosts
- Rabbit