Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PCSK6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: NYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGI

Rabbit Polyclonal Anti-PCSK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR

Rabbit Polyclonal Anti-PCSK6 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen PACE4 / PCSK6 antibody was raised against synthetic 16 amino acid peptide from internal region of human PACE4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rabbit (100%); Marmoset (94%); Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Pig, Opossum (88%); Bat (81%).