PACE4 (PCSK6) Rabbit Polyclonal Antibody

CAT#: TA329886

Rabbit Polyclonal Anti-PCSK6 Antibody

Product Images

WB Suggested Anti-PCSK6 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PCSK6 is expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: proprotein convertase subtilisin/kexin type 6
• Database Link:
  NP_612193
  Entrez Gene 5046 Human
  UniProt ID P29122
• Background: PCSK6 is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. This gene is thought to play a role in tumor progression.
• Synonyms: PACE4; SPC4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 92%; Bovine: 77%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein