USD 524.00
In Stock
Rabbit Monoclonal Antibody against PRNP (Clone EP1802Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PRNP (Clone EP1802Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-PRNP Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRNP |
Rabbit Polyclonal Prion protein Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Prion protein Antibody
Applications | WB |
Reactivities | Bovine, Sheep |
Conjugation | Unconjugated |
Immunogen | Amino acids 142-148 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
Applications | WB |
Reactivities | Bovine, Sheep, Avian |
Conjugation | Unconjugated |
Immunogen | Amino acids 162-170 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
Applications | WB |
Reactivities | Bovine, Sheep |
Conjugation | Unconjugated |
Immunogen | Amino acids 217-229 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Anti-PRNP Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF |
PRNP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PRNP |
PRNP rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PRNP |
Prion Protein Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Prion Protein |
Prion Protein Rabbit monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |