Primary Antibodies

Jump to Filters
View as table Download
RAB5B Rabbit Polyclonal Antibody
TA342184

USD 375.00

5 Days

Rabbit polyclonal Anti-RAB5B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5B antibody: synthetic peptide directed towards the N terminal of human RAB5B. Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE
RAB5B Rabbit Polyclonal Antibody
TA380643

USD 220.00

3 Weeks

RAB5B Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human RAB5B (NP_002859.1).
Modifications Unmodified