RAB5B Rabbit Polyclonal Antibody

CAT#: TA342184

Rabbit polyclonal Anti-RAB5B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RAB5B"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human, Mouse, Zebrafish
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAB5B antibody: synthetic peptide directed towards the N terminal of human RAB5B. Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 24 kDa
Gene Name RAB5B, member RAS oncogene family
Background Protein transport. Probably involved in vesicular traffic.
Synonyms member RAS oncogene family; RAB5B
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways Endocytosis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.