Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-Rab5b Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5b produced in E. coli.

Rabbit polyclonal Anti-RAB5B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5B antibody: synthetic peptide directed towards the N terminal of human RAB5B. Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

RAB5B Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human RAB5B (NP_002859.1).
Modifications Unmodified