RARG rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RARG |
RARG rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RARG |
Rabbit Polyclonal antibody to Retinoic Acid Receptor gamma (retinoic acid receptor, gamma)
Applications | IF |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 119 and 454 of Retinoic Acid Receptor gamma |
Rabbit Polyclonal Anti-RARG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RARG antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: SPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPR |
Rabbit Polyclonal Anti-RARG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the middle region of human RARG. Synthetic peptide located within the following region: QYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITK |
Rabbit Polyclonal Anti-RARG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: YPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTS |
RARG Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse RARG |
RARG rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RARG |
RARG Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 195-454 of human RARG (NP_000957.1). |
Modifications | Unmodified |