Retinoic Acid Receptor gamma (RARG) Rabbit Polyclonal Antibody

CAT#: TA335181

Rabbit Polyclonal Anti-RARG Antibody

Product Images

WB Suggested Anti-RARG Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RARG antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: SPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: retinoic acid receptor gamma
• Database Link:
  NP_000957
  Entrez Gene 19411 MouseEntrez Gene 5916 Human
  UniProt ID P13631
• Background: RARG is a receptor for retinoic acid. This metabolite has profound effects on vertebrate development. Retinoic acid is a morphogen and is a powerful teratogen. RARG controls cell function by directly regulating gene expression.
• Synonyms: NR1B3; RARC
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors