Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to Retinoic Acid Receptor gamma (retinoic acid receptor, gamma)
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 119 and 454 of Retinoic Acid Receptor gamma |
Rabbit Polyclonal Anti-RARG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARG antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: SPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPR |
Rabbit Polyclonal Anti-RARG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the middle region of human RARG. Synthetic peptide located within the following region: QYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITK |
Rabbit Polyclonal Anti-RARG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: YPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTS |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) RARG mouse monoclonal antibody,clone OTI3G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RARG Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse RARG |
RARG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 195-454 of human RARG (NP_000957.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
RARG mouse monoclonal antibody,clone OTI3G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Retinoic Acid Receptor gamma (RARG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G1]
USD 420.00
4 Weeks
RARG mouse monoclonal antibody,clone OTI3G1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
RARG mouse monoclonal antibody,clone OTI3G1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
RARG mouse monoclonal antibody,clone OTI3G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RARG