RCOR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RCOR1 |
RCOR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RCOR1 |
Rabbit Polyclonal Anti-RCOR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS |
Rabbit Polyclonal Anti-RCOR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the C terminal of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS |
Rabbit Polyclonal Anti-RCOR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RCOR1 Antibody: synthetic peptide directed towards the middle region of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS |
RCOR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RCOR1 |
CoREST/RCOR1 Rabbit polyclonal Antibody
Applications | ChIP, IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 256-485 of human CoREST/CoREST/RCOR1 (NP_055971.2). |
Modifications | Unmodified |