Primary Antibodies

View as table Download

SPTLC1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide derived from the Human Sserine Palmitoyltransferase enzyme

Rabbit Polyclonal SPT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen SPT1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SPT1. The immunogen is located within amino acids 380 - 430 of SPT1.

Rabbit Polyclonal Anti-SPTLC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI

SPTLC1 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from the human serine palmitoyltransferase enzyme

Rabbit Polyclonal Anti-SPTLC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY

Rabbit Polyclonal Anti-SPTLC1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SPTLC1

SPTLC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SPTLC1

SPTLC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 37-310 of human SPTLC1 (NP_006406.1).
Modifications Unmodified