Primary Antibodies

View as table Download

Rabbit Anti-Human TLR5 Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLR5 antibody was raised against synthetic peptide from human TLR5.

Rabbit Polyclonal TLR5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLR5 antibody was raised against a peptide corresponding to 16 amino acids near the center of human TLR5.

Rabbit Polyclonal TLR5 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5.

Rabbit Polyclonal TLR5 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR5 antibody was raised against a peptide corresponding to 15 amino acids near the carboxy terminus of human TLR5. The immunogen is located within the last 50 amino acids of TLR5.

Rabbit Polyclonal anti-TLR5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR5 antibody: synthetic peptide directed towards the N terminal of human TLR5. Synthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH

Rabbit Polyclonal Anti-TLR5 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR5

TLR5 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR5

TLR5 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TLR5