Germany
Japan
United Kingdom
China
VPS45A (VPS45) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 460-489 amino acids from the C-terminal region of human VPS45 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-Vps45 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vps45 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDH |
Rabbit Polyclonal Anti-Vps45 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vps45 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Vps45. Synthetic peptide located within the following region: PFLHETLDHLIKGRLKENLYPYLGPSTLRDRPQDIIVFIIGGATYEEALT |
Active filters
Target Symbol
- VPS45
Antibody Hosts
- Rabbit