Vps45 Rabbit Polyclonal Antibody

CAT#: TA340170

Rabbit Polyclonal Anti-Vps45 Antibody

Product Images

WB Suggested Anti-Vps45 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Vps45 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: vacuolar protein sorting 45
• Database Link:
  NP_038869
  Entrez Gene 22365 Mouse
  UniProt ID P97390
• Background: Vps45 may play a role in vesicle-mediated protein trafficking from the Golgi stack through the trans-Golgi network.
• Synonyms: h-vps45; H1; H1VPS45; hlVps45; VPS45A; VPS45B; VPS54A; VSP45; VSP45A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%