CXCR4 Mouse Monoclonal Antibody, clone 772AA17
Applications | Assay, FC |
Reactivities | Human |
Conjugation | Unconjugated |
CXCR4 Mouse Monoclonal Antibody, clone 772AA17
Applications | Assay, FC |
Reactivities | Human |
Conjugation | Unconjugated |
CXCR4 Mouse Monoclonal Antibody, clone 772AA80
Applications | Assay, FC |
Reactivities | Human |
Conjugation | Unconjugated |
CXCR4 Mouse Monoclonal Antibody, clone 772AA101
Applications | Assay, FC |
Reactivities | Human |
Conjugation | Unconjugated |
CXCR4 Mouse Monoclonal Antibody, clone 772X132
Applications | Assay, FC |
Reactivities | Human |
CXCR4 Mouse Monoclonal Antibody, clone 772X122
Applications | Assay, FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CTNNB1 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |