beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

CAT#: TA330026

Rabbit Polyclonal Anti-CTNNB1 Antibody

Product Images

CTNNB1 antibody - middle region validated by WB using HCT116 cell lysate

• 

  WB Suggested Anti-CTNNB1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Fetal Heart

• 

  CTNNB1 antibody - middle region validated by CHIP using HCT116 cell lysate

• 

  CTNNB1 antibody - middle region validated by CHIP using HCT116 cell lysate

Specifications

Product Data

• Applications: Assay, WB
• Recommended Dilution: WB, CHIP
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 85 kDa
• Gene Name: catenin beta 1
• Database Link:
  NP_001895
  Entrez Gene 1499 Human
  UniProt ID P35222
• Background: The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Three transcript variants encoding the same protein have been found for this gene.
• Synonyms: armadillo; CTNNB; MRD19
• Note: Immunogen sequence homology: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Zebrafish: 100%; African clawed frog: 92%; Chicken: 92%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Focal adhesion, Leukocyte transendothelial migration, Melanogenesis, Pathogenic Escherichia coli infection, Pathways in cancer, Prostate cancer, Thyroid cancer, Tight junction, Wnt signaling pathway