Primary Antibodies

Jump to Filters
View as table Download
H2A.Z (H2AFZ) Rabbit Polyclonal Antibody
TA308893

USD 415.00

5 Days

Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z
H3FA (HIST1H3A) Rabbit Polyclonal Antibody
TA347165

USD 430.00

5 Days

Rabbit Polyclonal H3K9me3 Antibody

Applications Assay, Dot, ELISA, IF, WB
Reactivities Human, Mouse
Immunogen The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide.
H3FA (HIST1H3A) Mouse Monoclonal Antibody
TA347150

USD 450.00

5 Days

Mouse Monoclonal H3K4me1 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human
H3FA (HIST1H3A) Rabbit Polyclonal Antibody
TA347202

USD 430.00

5 Days

Rabbit Polyclonal H3K4me3 Antibody

Applications Assay, Dot, ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide.
HIST2H2BF Rabbit Polyclonal Antibody
TA336063

USD 375.00

5 Days

Rabbit Polyclonal Anti-HIST2H2BF Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIST2H2BF Antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF. Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH