HIST2H2BF Rabbit Polyclonal Antibody

CAT#: TA336063

Rabbit Polyclonal Anti-HIST2H2BF Antibody

Product Images

WB Suggested Anti-HIST2H2BF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Small Intestine

• 

  Chromatin Immunoprecipitation (ChIP) Using HIST2H2BF antibody and HCT116 Cells

Specifications

Product Data

• Applications: Assay, WB
• Recommended Dilution: WB, ChIP
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HIST2H2BF Antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF. Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: histone cluster 2, H2bf
• Database Link:
  NP_001019770
  Entrez Gene 440689 Human
  UniProt ID Q5QNW6
• Background: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
• Synonyms: FLJ35099; FLJ56780; FLJ56787; MGC131639
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Systemic lupus erythematosus