Primary Antibodies

Jump to Filters
View as table Download
Pax7 Rabbit Polyclonal Antibody
TA329194

USD 375.00

2 Weeks

Rabbit Polyclonal anti-Pax7 antibody

Applications IF, WB
Reactivities Mouse, Rat
Immunogen The immunogen for anti-Pax7 antibody: synthetic peptide directed towards the middle region of human Pax7. Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ