Pax7 Rabbit Polyclonal Antibody

CAT#: TA329194

Rabbit Polyclonal anti-Pax7 antibody

Product Images

WB Suggested Anti-Pax7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Rat Muscle

• 

  Sample Type : C2C12;

• 

  Immunofluorescence -- Sample Type: Overexpression of Pax7 in C2C12 cellsDilution: 1:100

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pax7 antibody: synthetic peptide directed towards the middle region of human Pax7. Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: paired box 7
• Database Link:
  NP_001178913
  Entrez Gene 18509 MouseEntrez Gene 500574 Rat
• Background: The function of Pax7 remains unknown.
• Synonyms: FLJ37460; HUP1; PAX7B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%