Primary Antibodies

View as table Download

NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A.

Rabbit polyclonal anti-SCN9A antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCN9A.

Rabbit Polyclonal Anti-Human NaV1.5

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with amino acid residues 1978-2016 of human Nav1.5. Intracellular, C-terminus.

SCN1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 70-98 amino acids from the N-terminal region of Human SCN1B

Rabbit Polyclonal Anti-SCN9A Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SCN9A / Nav1.7 antibody was raised against synthetic 17 amino acid peptide from internal region of human SCN9A / Nav1.7. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Panda, Dog, Bovine, Horse, Rabbit, Pig (94%); Rat, Hamster, Bat (88%); Elephant, Platypus (82%).

NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A

Rabbit polyclonal Sodium Channel-pan antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human sodium channel.

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST

SCN2A rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

SCN3A / Nav1.3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Human
Immunogen SCN3A / Nav1.3 antibody was raised against synthetic 18 amino acid peptide from internal region of human SCN3A / Nav1.3. Percent identity with other species by BLAST analysis: Human, Chimpanzee (100%); Monkey, Galago (94%); Orangutan, Gibbon, Marmoset, Mouse, Bovine, Guinea pig (89%); Rat, Hamster, Panda, Dog (83%).

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit

Anti-SCN2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit

Anti-SCN2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit

Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/12A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/13A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN11A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN11A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN10A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-45 amino acids of human sodium channel, voltage-gated, type X, alpha subunit

Anti-SCN10A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-45 amino acids of human sodium channel, voltage-gated, type X, alpha subunit

Anti-SCN9A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-38 amino acids of human sodium channel, voltage-gated, type IX, alpha subunit

Anti-SCN9A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-38 amino acids of human sodium channel, voltage-gated, type IX, alpha subunit

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A

Rabbit Polyclonal Anti-SCN1B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN1B

Rabbit Polyclonal Anti-SCN9A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN9A