Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CPT1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA

Rabbit polyclonal anti-CPT1B antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CPT1B.

CPT1B (760-772) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Synthetic peptide from C-term of human CPT1B

Goat Anti-CPT1B (isoform 1) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DIADLFQVPKAYS, from the C Terminus of the protein sequence according to NP_689452.1; NP_689451.1; NP_004368.1; NP_001138609.1; NP_001138607.1; NP_001138606.1; NP_001138608.1.

CPT1B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPT1B

CPT1B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPT1B

CPT1B Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 533-772 of human CPT1B (NP_004368.1).
Modifications Unmodified