CPT1B Rabbit Polyclonal Antibody

CAT#: TA339410

Rabbit Polyclonal Anti-CPT1B Antibody

Product Images

Sample Type: 1: 45ug human capan1 cell lysate Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody: ilution: 1: 5000; Color/Signal Descriptions: ARP46444-[QC16367]-WB-image-02; Gene Name: CPT1B; Submitted by: Dr. Panka

• 

  WB Suggested Anti-CPT1B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysate.CPT1B is supported by BioGPS gene expression data to be expressed in HT1080

• 

  rsearcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE; Application: IHC; Species+tissue/cell type: Species+tissue/cell type: Human Capan1 cells; Primary antibody dilution: 1: 300; Secondary antibody: Anti-rabbit Alexa Fluor 488; Secondary antibody dilution:

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 88 kDa
• Gene Name: carnitine palmitoyltransferase 1B
• Database Link:
  NP_004368
  Entrez Gene 12895 MouseEntrez Gene 1375 Human
  UniProt ID Q92523
• Background: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene. [provided by RefSeq, Jun 2009]
• Synonyms: CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 93%; Bovine: 93%; Zebrafish: 92%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Fatty acid metabolism, PPAR signaling pathway