Primary Antibodies

View as table Download

Rabbit polyclonal antibody to HNF-1 alpha (HNF1 homeobox A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 35 and 268 of HNF1 alpha (Uniprot ID#P20823)

Rabbit polyclonal NeuroD1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1.

Rabbit Polyclonal Anti-HNF1A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A

Rabbit Polyclonal HES-1 Antibody

Applications IHC
Reactivities Bovine, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 230-280 of human HES1 was used as the immunogen.

Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI7B9 (formerly 7B9)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A

Anti-HES1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-HES1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HES1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HES1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HES1 mouse monoclonal antibody, clone OTI7B9 (formerly 7B9)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

HES1 mouse monoclonal antibody, clone OTI7B9 (formerly 7B9)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

HES1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HES1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated