Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to PSAT1 (phosphoserine aminotransferase 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 48 and 328 of PSAT1 (Uniprot ID#Q9Y617)

Rabbit polyclonal anti-AOX1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AOX1.

Rabbit Polyclonal Anti-PSAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSAT1 antibody: synthetic peptide directed towards the N terminal of human PSAT1. Synthetic peptide located within the following region: ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY

Carrier-free (BSA/glycerol-free) PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-AOX1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1

Anti-AOX1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1

PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PDXK mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PNPO mouse monoclonal antibody,clone 1G9, Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PNPO mouse monoclonal antibody,clone 1G9, HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".