Primary Antibodies

Jump to Filters
View as table Download
HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody
TA371635

USD 380.00

4 Weeks

HNF1A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNF1A
HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody
TA308567

USD 415.00

2 Weeks

Rabbit polyclonal antibody to HNF-1 alpha (HNF1 homeobox A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 35 and 268 of HNF1 alpha (Uniprot ID#P20823)
HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody
TA339211

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNF1A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody
TA321150

USD 345.00

4 Weeks

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A
HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody
TA321151

USD 345.00

4 Weeks

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A
HNF1A Rabbit Polyclonal Antibody
TA367401

USD 380.00

4 Weeks

HNF1A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNF1A
HNF1A Rabbit Polyclonal Antibody
TA371147

USD 380.00

4 Weeks

HNF1A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNF1A