SPSB2 mouse monoclonal antibody, clone 1E6
Applications | ELISA, IHC, WB |
Reactivities | Human |
SPSB2 mouse monoclonal antibody, clone 1E6
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-SPSB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rhesus macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the N terminal of human SPSB2. Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR |
Rabbit Polyclonal Anti-SPSB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rhesus macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the C terminal of human SPSB2. Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG |
SPSB2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SPSB2 |