Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RARRES3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RARRES3

Rabbit Polyclonal Anti-RARRES3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RARRES3 antibody: synthetic peptide directed towards the middle region of human RARRES3. Synthetic peptide located within the following region: FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV