PLAAT4 Rabbit Polyclonal Antibody

CAT#: TA339424

Rabbit Polyclonal Anti-RARRES3 Antibody

Product Images

WB Suggested Anti-RARRES3 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RARRES3 antibody: synthetic peptide directed towards the middle region of human RARRES3. Synthetic peptide located within the following region: FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: retinoic acid receptor responder 3
• Database Link:
  NP_004576
  Entrez Gene 5920 Human
  UniProt ID Q9UL19
• Background: Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator. [provided by RefSeq, Jul 2008]
• Synonyms: 2-3; HRASLS4; HRSL4; PLA1; RIG1; TIG3
• Note: Immunogen Sequence Homology: Human: 93%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transmembrane